PIN4 antibody (N-Term)
-
- Target See all PIN4 Antibodies
- PIN4 (Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting 4 Protein (PIN4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PIN4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PIN4 antibody was raised against the N terminal of PIN4
- Purification
- Affinity purified
- Immunogen
- PIN4 antibody was raised using the N terminal of PIN4 corresponding to a region with amino acids MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSAD
- Top Product
- Discover our top product PIN4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PIN4 Blocking Peptide, catalog no. 33R-6296, is also available for use as a blocking control in assays to test for specificity of this PIN4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIN4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIN4 (Peptidyl Prolyl Cis/Trans Isomerase NIMA Interacting 4 Protein (PIN4))
- Alternative Name
- PIN4 (PIN4 Products)
- Synonyms
- 2410002I22Rik antibody, EPVH antibody, Par14 antibody, PAR14 antibody, PAR17 antibody, zgc:110008 antibody, peptidylprolyl cis/trans isomerase, NIMA-interacting 4 antibody, protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin) antibody, protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin) antibody, PIN4 antibody, Pin4 antibody, pin4 antibody
- Background
- This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle and chromatin remodeling.
- Molecular Weight
- 16 kDa (MW of target protein)
-