Trmt11 antibody
-
- Target See all Trmt11 Antibodies
- Trmt11 (tRNA Methyltransferase 11 Homolog (Trmt11))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Trmt11 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TRMT11 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP
- Top Product
- Discover our top product Trmt11 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRMT11 Blocking Peptide, catalog no. 33R-4021, is also available for use as a blocking control in assays to test for specificity of this TRMT11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRMT11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Trmt11 (tRNA Methyltransferase 11 Homolog (Trmt11))
- Alternative Name
- TRMT11 (Trmt11 Products)
- Synonyms
- 2410075D05Rik antibody, 3110045I18Rik antibody, AW213713 antibody, Mds024 antibody, MDS024 antibody, C6orf75 antibody, TRM11 antibody, TRMT11-1 antibody, tRNA methyltransferase 11 antibody, tRNA methyltransferase 11 homolog antibody, tRNA methyltransferase 11 homolog L homeolog antibody, Trmt11 antibody, trmt11.L antibody, TRMT11 antibody
- Background
- TRMT11 belongs to the methyltransferase superfamily. It is a catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.
- Molecular Weight
- 53 kDa (MW of target protein)
-