ITGB1BP3 antibody (Middle Region)
-
- Target See all ITGB1BP3 Antibodies
- ITGB1BP3 (Integrin beta 1 Binding Protein 3 (ITGB1BP3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ITGB1BP3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ITGB1 BP3 antibody was raised against the middle region of ITGB1 P3
- Purification
- Affinity purified
- Immunogen
- ITGB1 BP3 antibody was raised using the middle region of ITGB1 P3 corresponding to a region with amino acids YKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPDPPGLFDGHVWPMYQKY
- Top Product
- Discover our top product ITGB1BP3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ITGB1BP3 Blocking Peptide, catalog no. 33R-10154, is also available for use as a blocking control in assays to test for specificity of this ITGB1BP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB0 P3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ITGB1BP3 (Integrin beta 1 Binding Protein 3 (ITGB1BP3))
- Alternative Name
- ITGB1BP3 (ITGB1BP3 Products)
- Synonyms
- ITGB1BP3 antibody, MIBP antibody, NRK2 antibody, itgb1bp3 antibody, 2310015C21Rik antibody, Itgb1bp3 antibody, Mibp antibody, zgc:103408 antibody, nicotinamide riboside kinase 2 antibody, integrin beta 1 binding protein 3 antibody, nicotinamide riboside kinase 2 S homeolog antibody, NMRK2 antibody, ITGB1BP3 antibody, nmrk2.S antibody, nmrk2 antibody, Nmrk2 antibody
- Background
- ITGB1BP3 catalyzes the phosphorylation of nicotinamide riboside (NR) and nicotinic acid riboside (NaR) to form nicotinamide mononucleotide (NMN) and nicotinic acid mononucleotide (NaMN).
- Molecular Weight
- 26 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development
-