CENPA antibody (Middle Region)
-
- Target See all CENPA Antibodies
- CENPA (Centromere Protein A (CENPA))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CENPA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CENPA antibody was raised against the middle region of CENPA
- Purification
- Affinity purified
- Immunogen
- CENPA antibody was raised using the middle region of CENPA corresponding to a region with amino acids ALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
- Top Product
- Discover our top product CENPA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CENPA Blocking Peptide, catalog no. 33R-1362, is also available for use as a blocking control in assays to test for specificity of this CENPA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CENPA (Centromere Protein A (CENPA))
- Alternative Name
- CENPA (CENPA Products)
- Synonyms
- CENP-A antibody, CenH3 antibody, Cenp-A antibody, cenpx antibody, cenp-a antibody, sim2 antibody, Cenp-a antibody, RGD1563607 antibody, CENPA antibody, centromere protein A antibody, centromere protein-A antibody, centromeric histone-3 like protein antibody, centromere-specific histone H3 CENP-A antibody, cenp-A antibody, centromere protein A L homeolog antibody, histone H3-like centromeric protein A antibody, CENPA antibody, Cenpa antibody, CENP-A antibody, cenpa antibody, cenp-A antibody, cnp1 antibody, HAN_3g422 antibody, Cenp-a antibody, cenpa.L antibody, CMU_016480 antibody
- Background
- Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. CENPA is a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle.
- Molecular Weight
- 16 kDa (MW of target protein)
- Pathways
- Chromatin Binding, Maintenance of Protein Location
-