NUSAP1 antibody (Middle Region)
-
- Target See all NUSAP1 Antibodies
- NUSAP1 (Nucleolar and Spindle Associated Protein 1 (NUSAP1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NUSAP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NUSAP1 antibody was raised against the middle region of NUSAP1
- Purification
- Affinity purified
- Immunogen
- NUSAP1 antibody was raised using the middle region of NUSAP1 corresponding to a region with amino acids AENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAH
- Top Product
- Discover our top product NUSAP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NUSAP1 Blocking Peptide, catalog no. 33R-1139, is also available for use as a blocking control in assays to test for specificity of this NUSAP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUSAP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NUSAP1 (Nucleolar and Spindle Associated Protein 1 (NUSAP1))
- Alternative Name
- NUSAP1 (NUSAP1 Products)
- Synonyms
- ANKT antibody, BM037 antibody, LNP antibody, NUSAP antibody, PRO0310p1 antibody, Q0310 antibody, SAPL antibody, 2610201A12Rik antibody, AI481307 antibody, AW547774 antibody, BB165529 antibody, NuSAP antibody, YF-9 antibody, ankt antibody, fb76a01 antibody, fi37a11 antibody, sb:cb490 antibody, wu:fb76a01 antibody, wu:fi37a11 antibody, lnp antibody, nusap antibody, nusap1 antibody, sapl antibody, nucleolar and spindle associated protein 1 antibody, nucleolar and spindle associated protein 1 L homeolog antibody, nucleolar and spindle associated protein 1 S homeolog antibody, NUSAP1 antibody, Nusap1 antibody, nusap1 antibody, nusap1.L antibody, nusap1.S antibody
- Background
- NUSAP1 is a microtubule-associated protein with the capacity to bundle and stabilize microtubules. It may associate with chromosomes and promote the organization of mitotic spindle microtubules around them.
- Molecular Weight
- 49 kDa (MW of target protein)
-