FAD Synthetase antibody

Catalog No. ABIN630740

Product Details anti-FAD Synthetase Antibody

Target: FAD Synthetase

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAD Synthetase antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: FLAD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGRSVTAGIIIVGDEILKGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FLAD1 Blocking Peptide, catalog no. 33R-7130, is also available for use as a blocking control in assays to test for specificity of this FLAD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLAD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAD Synthetase

Target: FAD Synthetase

Alternative Name: FLAD1 (FAD Synthetase Products)

Synonyms: wu:fa92c06 antibody, zgc:91843 antibody, fad1 antibody, fads antibody, pp591 antibody, FAD1 antibody, FADS antibody, RP11-307C12.7 antibody, A930017E24Rik antibody, Pp591 antibody, FAD synthetase (predicted) antibody, FAD synthetase antibody, flavin adenine dinucleotide synthetase 1 antibody, flavin adenine dinucleotide synthetase 1 L homeolog antibody, SPCC1235.04c antibody, GY4MC1_1590 antibody, SpiBuddy_1392 antibody, Psed_2275 antibody, Spico_0597 antibody, Trebr_1967 antibody, Geoth_1673 antibody, Ccan_14090 antibody, flad1 antibody, FLAD1 antibody, flad1.L antibody, Flad1 antibody

Background: FLAD1 catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.

Molecular Weight: 65 kDa (MW of target protein)