ALG1L3P antibody (C-Term)
ALG1L3P
Reactivity: Human
WB
Host: Rabbit
Polyclonal
unconjugated
1 image
-
- Target See all ALG1L3P products
- ALG1L3P (Asparagine-Linked Glycosylation 1-Like 3, Pseudogene (ALG1L3P))
- Binding Specificity
- C-Term
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ALG1L3P antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LOC650515 antibody was raised against the C terminal of LOC650515
- Purification
- Affinity purified
- Immunogen
- LOC650515 antibody was raised using the C terminal of LOC650515 corresponding to a region with amino acids VQTVLPLVMDTELLGQRLKPQGPCCPSRSFFSESQGKSFRVAPPSGQKLI
-
anti-Asparagine-Linked Glycosylation 1-Like 3, Pseudogene (ALG1L3P) antibody
ALG1L3P Reactivity: Human WB, ELISA Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LOC650515 Blocking Peptide, catalog no. 33R-9764, is also available for use as a blocking control in assays to test for specificity of this LOC650515 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC650515 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALG1L3P (Asparagine-Linked Glycosylation 1-Like 3, Pseudogene (ALG1L3P))
- Abstract
- ALG1L3P Products
- Synonyms
- asparagine-linked glycosylation 1-like 3, pseudogene antibody, ALG1L3P antibody
- Background
- The sequence of LOC650515 is derived from an annotated genomic sequence (NW_922073) using gene prediction method: GNOMON, supported by EST evidence. The exact function of LOC650515 remains unknown.
- Molecular Weight
- 39 kDa (MW of target protein)
-
You are here:
