PHLDA1 antibody (Middle Region)
-
- Target See all PHLDA1 Antibodies
- PHLDA1 (Pleckstrin Homology-Like Domain, Family A, Member 1 (PHLDA1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PHLDA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PHLDA1 antibody was raised against the middle region of PHLDA1
- Purification
- Affinity purified
- Immunogen
- PHLDA1 antibody was raised using the middle region of PHLDA1 corresponding to a region with amino acids PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP
- Top Product
- Discover our top product PHLDA1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PHLDA1 Blocking Peptide, catalog no. 33R-6986, is also available for use as a blocking control in assays to test for specificity of this PHLDA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHLDA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PHLDA1 (Pleckstrin Homology-Like Domain, Family A, Member 1 (PHLDA1))
- Alternative Name
- PHLDA1 (PHLDA1 Products)
- Synonyms
- DT1P1B11 antibody, PHRIP antibody, TDAG51 antibody, Tdag antibody, pleckstrin homology like domain family A member 1 antibody, pleckstrin homology like domain, family A, member 1 antibody, pleckstrin homology-like domain, family A, member 1 antibody, pleckstrin homology-like domain, family A, member 1 L homeolog antibody, PHLDA1 antibody, Phlda1 antibody, phlda1.L antibody
- Background
- PHLDA1 is an evolutionarily conserved proline-histidine rich nuclear protein. It may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.
- Molecular Weight
- 45 kDa (MW of target protein)
-