RALGPS2 antibody (N-Term)
-
- Target See all RALGPS2 Antibodies
- RALGPS2 (Ral GEF with PH Domain and SH3 Binding Motif 2 (RALGPS2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RALGPS2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RALGPS2 antibody was raised against the n terminal of RALGPS2
- Purification
- Affinity purified
- Immunogen
- RALGPS2 antibody was raised using the N terminal of RALGPS2 corresponding to a region with amino acids MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTP
- Top Product
- Discover our top product RALGPS2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RALGPS2 Blocking Peptide, catalog no. 33R-5849, is also available for use as a blocking control in assays to test for specificity of this RALGPS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALGPS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RALGPS2 (Ral GEF with PH Domain and SH3 Binding Motif 2 (RALGPS2))
- Alternative Name
- RALGPS2 (RALGPS2 Products)
- Synonyms
- RALGPS1 antibody, RALGPS2 antibody, dJ595C2.1 antibody, 1810020P17Rik antibody, 2210408F11Rik antibody, 4921528G01Rik antibody, 9130014M22Rik antibody, AU043409 antibody, AW046161 antibody, Ral GEF with PH domain and SH3 binding motif 2 antibody, RALGPS2 antibody, ralgps2 antibody, Ralgps2 antibody
- Background
- RALGPS2 is a guanine nucleotide exchange factor for the small GTPase RALA. RALGPS2 may be involved in cytoskeletal organization. RALGPS2 may also be involved in the stimulation of transcription in a Ras-independent fashion.
- Molecular Weight
- 32 kDa (MW of target protein)
-