ABAT antibody (Middle Region)
-
- Target See all ABAT Antibodies
- ABAT (4-Aminobutyrate Aminotransferase (ABAT))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ABAT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ABAT antibody was raised against the middle region of ABAT
- Purification
- Affinity purified
- Immunogen
- ABAT antibody was raised using the middle region of ABAT corresponding to a region with amino acids IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW
- Top Product
- Discover our top product ABAT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ABAT Blocking Peptide, catalog no. 33R-4009, is also available for use as a blocking control in assays to test for specificity of this ABAT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABAT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABAT (4-Aminobutyrate Aminotransferase (ABAT))
- Alternative Name
- ABAT (ABAT Products)
- Synonyms
- cb880 antibody, fj82a01 antibody, wu:fj82a01 antibody, BA0325 antibody, PSPTO0259 antibody, PSPTO0301 antibody, PSPTO1890 antibody, GABA-AT antibody, GABAT antibody, NPD009 antibody, GABA-T antibody, L-AIBAT antibody, 9630038C02Rik antibody, AI255750 antibody, ENSMUSG00000051226 antibody, Gabaat antibody, Gabat antibody, Gm9851 antibody, I54 antibody, Laibat antibody, X61497 antibody, beta-AlaAT antibody, 4-aminobutyrate aminotransferase antibody, 4-aminobutyrate--2-oxoglutarate transaminase antibody, GABA aminotransferase PLP-dependent PuuE antibody, 4-aminobutyrate aminotransferase, mitochondrial antibody, aspartate aminotransferase family protein antibody, 4-aminobutyrate aminotransferase S homeolog antibody, ABAT antibody, abat antibody, gabT antibody, puuE antibody, gabT-1 antibody, gabT-2 antibody, gabT-3 antibody, CNE01830 antibody, Mmwyl1_0047 antibody, CpipJ_CPIJ008729 antibody, KCR_RS04555 antibody, Bcenmc03_4909 antibody, Hden_0972 antibody, Dbac_2000 antibody, Mesil_2400 antibody, Trad_0121 antibody, abat.S antibody, Abat antibody
- Background
- 4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50 kDa subunits complexed to pyridoxal-5-phosphate. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities.4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde
- Molecular Weight
- 55 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-