Keratin 10 antibody

Catalog No. ABIN630798

Product Details anti-Keratin 10 Antibody

Target: Keratin 10 (KRT10)

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Keratin 10 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Cytokeratin 10 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cytokeratin 10 Blocking Peptide, catalog no. 33R-2526, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Keratin 10

Target: Keratin 10 (KRT10)

Alternative Name: Cytokeratin 10 (KRT10 Products)

Synonyms: BCIE antibody, BIE antibody, CK10 antibody, EHK antibody, K10 antibody, KPP antibody, D130054E02Rik antibody, K1C1 antibody, Krt-1.10 antibody, Krt1-10 antibody, Ka10 antibody, Ker10 antibody, KRT10 antibody, KRT25 antibody, KRT27 antibody, KRT28 antibody, keratin 10 antibody, keratin 10, type I S homeolog antibody, keratin, type I cytoskeletal 25 antibody, KRT10 antibody, Krt10 antibody, krt10.S antibody, LOC101085587 antibody

Background: KRT10 is a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in the gene encoding KRT10 are associated with epidermolytic hyperkeratosis.

Molecular Weight: 59 kDa (MW of target protein)