TSPAN1 antibody (Middle Region)
-
- Target See all TSPAN1 Antibodies
- TSPAN1 (Tetraspanin 1 (TSPAN1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TSPAN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Tetraspanin 1 antibody was raised against the middle region of TSPAN1
- Purification
- Affinity purified
- Immunogen
- Tetraspanin 1 antibody was raised using the middle region of TSPAN1 corresponding to a region with amino acids TMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKA
- Top Product
- Discover our top product TSPAN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Tetraspanin 1 Blocking Peptide, catalog no. 33R-9202, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TSPAN1 (Tetraspanin 1 (TSPAN1))
- Alternative Name
- Tetraspanin 1 (TSPAN1 Products)
- Synonyms
- TSPAN1 antibody, 9030418M05Rik antibody, NET1 antibody, TM4C antibody, TM4SF antibody, tetraspanin 1 antibody, tetraspanin 1 L homeolog antibody, TSPAN1 antibody, tspan1.L antibody, Tspan1 antibody
- Background
- The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.
- Molecular Weight
- 26 kDa (MW of target protein)
-