HSPH1 antibody (Middle Region)
-
- Target See all HSPH1 Antibodies
- HSPH1 (Heat Shock 105kDa/110kDa Protein 1 (HSPH1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HSPH1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HSPH1 antibody was raised against the middle region of HSPH1
- Purification
- Affinity purified
- Immunogen
- HSPH1 antibody was raised using the middle region of HSPH1 corresponding to a region with amino acids EENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQ
- Top Product
- Discover our top product HSPH1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HSPH1 Blocking Peptide, catalog no. 33R-2377, is also available for use as a blocking control in assays to test for specificity of this HSPH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HSPH1 (Heat Shock 105kDa/110kDa Protein 1 (HSPH1))
- Alternative Name
- HSPH1 (HSPH1 Products)
- Synonyms
- hsp105 antibody, hsp105a antibody, hsp105b antibody, hsp110 antibody, hsph1b antibody, Hsp105 antibody, HSP105 antibody, HSP105A antibody, HSP105B antibody, NY-CO-25 antibody, 105kDa antibody, AI790491 antibody, Hsp110 antibody, hsp-E7I antibody, hsph1 antibody, hsph1a antibody, heat shock protein family H (Hsp110) member 1 antibody, heat shock protein family H (Hsp110) member 1 S homeolog antibody, heat shock protein 105 kDa antibody, heat shock 105kDa/110kDa protein 1 antibody, heat shock protein family H (Hsp110) member 1 L homeolog antibody, hsph1 antibody, hsph1.S antibody, HSPH1 antibody, LOC100546590 antibody, Hsph1 antibody, hsph1.L antibody
- Background
- HSPH1 prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. It inhibits HSPA8/HSC70 ATPase and chaperone activities.
- Molecular Weight
- 97 kDa (MW of target protein)
-