Transglutaminase 5 antibody (C-Term)
-
- Target See all Transglutaminase 5 (TGM5) Antibodies
- Transglutaminase 5 (TGM5)
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Transglutaminase 5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Transglutaminase 5 antibody was raised against the C terminal of TGM5
- Purification
- Affinity purified
- Immunogen
- Transglutaminase 5 antibody was raised using the C terminal of TGM5 corresponding to a region with amino acids VLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNVYVDFAL
- Top Product
- Discover our top product TGM5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Transglutaminase 5 Blocking Peptide, catalog no. 33R-9671, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Transglutaminase 5 (TGM5)
- Alternative Name
- Transglutaminase 5 (TGM5 Products)
- Synonyms
- TGM5 antibody, TGASE5 antibody, TGASEX antibody, TGMX antibody, TGX antibody, 2310007C07Rik antibody, TGx antibody, transglutaminase 5 antibody, TGM5 antibody, tgm5 antibody, Tgm5 antibody
- Background
- TGM5 belongs to the transglutaminase superfamily, transglutaminase family. It catalyzes the cross-linking of proteins and the conjugation of polyamines to proteins. It contributes to the formation of the cornified cell envelope of keratinocytes. Defects in TGM5 are a cause of peeling skin syndrome acral type (APSS).
- Molecular Weight
- 81 kDa (MW of target protein)
-