MYL6 antibody (N-Term)

Catalog No. ABIN630884

Product Details anti-MYL6 Antibody

Target: MYL6 (Myosin Light Chain 6, Alkali, Smooth Muscle and Non Muscle (MYL6))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MYL6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MYL6 antibody was raised against the N terminal of MYL6

Purification: Affinity purified

Immunogen: MYL6 antibody was raised using the N terminal of MYL6 corresponding to a region with amino acids CDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MYL6 Blocking Peptide, catalog no. 33R-1660, is also available for use as a blocking control in assays to test for specificity of this MYL6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYL6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MYL6

Target: MYL6 (Myosin Light Chain 6, Alkali, Smooth Muscle and Non Muscle (MYL6))

Alternative Name: MYL6 (MYL6 Products)

Synonyms: ESMLC antibody, LC17 antibody, LC17-GI antibody, LC17-NM antibody, LC17A antibody, LC17B antibody, MLC-3 antibody, MLC1SM antibody, MLC3NM antibody, MLC3SM antibody, zgc:103624 antibody, MLC3nm antibody, Myln antibody, myosin light chain 6 antibody, myosin, light chain 6, alkali, smooth muscle and non-muscle antibody, myosin light chain 6 L homeolog antibody, myosin, light polypeptide 6, alkali, smooth muscle and non-muscle antibody, MYL6 antibody, Myl6 antibody, myl6 antibody, myl6.L antibody

Background: MYL6 contains 3 EF-hand domains. It is the regulatory light chain of myosin. MYL6 does not bind calcium. Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.

Molecular Weight: 17 kDa (MW of target protein)