ARG2 antibody (Arg2, C-Term)
-
- Target See all ARG2 Antibodies
- ARG2 (Arginase, Type II (ARG2))
-
Binding Specificity
- Arg2, C-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ARG2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Arginase 2 antibody was raised against the C terminal of ARG2
- Purification
- Affinity purified
- Immunogen
- Arginase 2 antibody was raised using the C terminal of ARG2 corresponding to a region with amino acids SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT
- Top Product
- Discover our top product ARG2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Arginase 2 Blocking Peptide, catalog no. 33R-8306, is also available for use as a blocking control in assays to test for specificity of this Arginase 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARG2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARG2 (Arginase, Type II (ARG2))
- Alternative Name
- Arginase 2 (ARG2 Products)
- Synonyms
- AII antibody, AU022422 antibody, zgc:65793 antibody, zgc:85630 antibody, wu:fb67g02 antibody, ARG2 antibody, LeARG2 antibody, arg1 antibody, arg3 antibody, arg2 antibody, arg2-c antibody, arg2-b antibody, arginase 2 antibody, arginase type II antibody, arginase 2 L homeolog antibody, arginase 2 S homeolog antibody, ARG2 antibody, Arg2 antibody, arg2 antibody, arg2.L antibody, arg2.S antibody
- Background
- Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. ARG2 (type II isoform) is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney. The physiologic role of this isoform is poorly understood, it is thought to play a role in nitric oxide and polyamine metabolism.
- Molecular Weight
- 36 kDa (MW of target protein)
-