HSPB8 antibody (N-Term)

Catalog No. ABIN630901

Product Details anti-HSPB8 Antibody

Target: HSPB8 (Heat Shock 22kDa Protein 8 (HSPB8))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSPB8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HSPB8 antibody was raised against the N terminal of HSPB8

Purification: Affinity purified

Immunogen: HSPB8 antibody was raised using the N terminal of HSPB8 corresponding to a region with amino acids ADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSPB8 Blocking Peptide, catalog no. 33R-1092, is also available for use as a blocking control in assays to test for specificity of this HSPB8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPB8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSPB8

Target: HSPB8 (Heat Shock 22kDa Protein 8 (HSPB8))

Alternative Name: HSPB8 (HSPB8 Products)

Synonyms: CMT2L antibody, DHMN2 antibody, E2IG1 antibody, H11 antibody, HMN2 antibody, HMN2A antibody, HSP22 antibody, MGC64408 antibody, hsc70 antibody, wu:fb01g06 antibody, wu:fi48b06 antibody, fc09c11 antibody, wu:fc04b04 antibody, wu:fc09c11 antibody, zgc:64202 antibody, AU018630 antibody, AW413033 antibody, Cryac antibody, D5Ucla4 antibody, H11K antibody, HSP20-like antibody, Hsp22 antibody, heat shock protein family B (small) member 8 antibody, heat shock protein family B (small) member 8 L homeolog antibody, heat shock protein 8 antibody, heat shock protein b8 antibody, HSPB8 antibody, hspb8.L antibody, hspa8 antibody, hspb8 antibody, Hspb8 antibody

Background: HSPB8 belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of HSPB8 protein is induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, HSPB8 appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in the encoding HSPB8 gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease.

Molecular Weight: 21 kDa (MW of target protein)