MAP3K1 antibody (C-Term)

Catalog No. ABIN630931

This Rabbit Polyclonal antibody specifically detects MAP3K1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for MAP3K1 antibody (C-Term) (ABIN630931)

Target: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAP3K1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAP3K1 Antibody

Binding Specificity: C-Term

Specificity: MAP3 K1 antibody was raised against the C terminal of MAP3 1

Purification: Affinity purified

Immunogen: MAP3 K1 antibody was raised using the C terminal of MAP3 1 corresponding to a region with amino acids LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAP3K1 Blocking Peptide, (ABIN940346), is also available for use as a blocking control in assays to test for specificity of this MAP3K1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAP3K1

Target: MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))

Alternative Name: MAP3K1

Background: MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin and many growth factors.

Molecular Weight: 164 kDa (MW of target protein)

Pathways: MAPK Signaling, Interferon-gamma Pathway, Caspase Cascade in Apoptosis, TLR Signaling, Fc-epsilon Receptor Signaling Pathway, Activation of Innate immune Response, Regulation of Actin Filament Polymerization, Toll-Like Receptors Cascades