STING/TMEM173 antibody (Middle Region)

Catalog No. ABIN630932

Product Details anti-STING/TMEM173 Antibody

Target: STING/TMEM173 (TMEM173) (Transmembrane Protein 173 (TMEM173))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STING/TMEM173 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM173 antibody was raised against the middle region of TMEM173

Purification: Affinity purified

Immunogen: TMEM173 antibody was raised using the middle region of TMEM173 corresponding to a region with amino acids DPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM173 Blocking Peptide, catalog no. 33R-2109, is also available for use as a blocking control in assays to test for specificity of this TMEM173 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM173 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STING/TMEM173

Target: STING/TMEM173 (TMEM173) (Transmembrane Protein 173 (TMEM173))

Alternative Name: TMEM173 (TMEM173 Products)

Synonyms: ERIS antibody, MITA antibody, MPYS antibody, NET23 antibody, STING antibody, 2610307O08Rik antibody, Mita antibody, RGD1562552 antibody, transmembrane protein 173 antibody, TMEM173 antibody, Tmem173 antibody

Background: TMEM173 acts as a facilitator of innate immune signaling. It is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon (IFN-alpha and IFN-beta) and exert a potent anti-viral state following expression. TMEM173 may be involved in translocon function, the translocon possibly being able to influence the induction of type I interferons.It also may be involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II). TMEM173 mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Activation of Innate immune Response