Lamin B2 antibody (N-Term)

Catalog No. ABIN630994

Product Details anti-Lamin B2 Antibody

Target: Lamin B2 (LMNB2)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Lamin B2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Lamin B2 antibody was raised against the N terminal of LMNB2

Purification: Affinity purified

Immunogen: Lamin B2 antibody was raised using the N terminal of LMNB2 corresponding to a region with amino acids MATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELE

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Lamin B2 Blocking Peptide, catalog no. 33R-5781, is also available for use as a blocking control in assays to test for specificity of this Lamin B2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMNB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Lamin B2

Target: Lamin B2 (LMNB2)

Alternative Name: Lamin B2 (LMNB2 Products)

Synonyms: lmnb2-a antibody, LMNB2 antibody, lmn2 antibody, lamb2 antibody, Lamin-L(II) antibody, LOC100136040 antibody, im:7142331 antibody, lamin antibody, wu:fb94e05 antibody, wu:fb95e12 antibody, wu:fc15d06 antibody, wu:fc49h03 antibody, lamin-b2 antibody, lmnb2 antibody, LAMB2 antibody, LMN2 antibody, RGD1563803 antibody, lamin B2 S homeolog antibody, lamin B2 antibody, lamin B2 L homeolog antibody, lmnb2.S antibody, LMNB2 antibody, lmnb2 antibody, lmnb2.L antibody, Lmnb2 antibody

Background: The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression. Vertebrate lamins consist of two types, A and B. LMNB2 is one of the two B type proteins, B2.

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Apoptosis, Caspase Cascade in Apoptosis