DLD antibody (Middle Region)

Catalog No. ABIN631024

Product Details anti-DLD Antibody

Target: DLD (Dihydrolipoamide Dehydrogenase (DLD))

Binding Specificity: Middle Region

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DLD antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DLD antibody was raised against the middle region of DLD

Purification: Affinity purified

Immunogen: DLD antibody was raised using the middle region of DLD corresponding to a region with amino acids AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DLD Blocking Peptide, catalog no. 33R-1194, is also available for use as a blocking control in assays to test for specificity of this DLD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DLD

Target: DLD (Dihydrolipoamide Dehydrogenase (DLD))

Alternative Name: DLD (DLD Products)

Synonyms: DLDD antibody, DLDH antibody, E3 antibody, GCSL antibody, LAD antibody, PHE3 antibody, AI315664 antibody, AI746344 antibody, wu:fb24b05 antibody, DLD antibody, DDBDRAFT_0183800 antibody, DDBDRAFT_0216232 antibody, DDB_0183800 antibody, DDB_0216232 antibody, sc:d0402 antibody, dihydrolipoamide dehydrogenase antibody, dihydrolipoyl dehydrogenase antibody, deltaD antibody, DLD antibody, Dld antibody, dldh antibody, AT4G16155 antibody, CND05840 antibody, bfmBC antibody, GCSL antibody, LACBIDRAFT_182385 antibody, UREG_06178 antibody, lpd antibody, TAGG_RS02070 antibody, Arnit_2606 antibody, Mesil_1945 antibody, Trad_2118 antibody, Acear_0640 antibody, Fbal_0372 antibody, Ilyop_1890 antibody, Ftrac_1733 antibody, Ocepr_1753 antibody, Intca_2017 antibody, Deima_0504 antibody, dld antibody

Background: DLD is the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Cell RedoxHomeostasis