Monoamine Oxidase A antibody (Middle Region)
-
- Target See all Monoamine Oxidase A (MAOA) Antibodies
- Monoamine Oxidase A (MAOA)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Monoamine Oxidase A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAOA antibody was raised against the middle region of MAOA
- Purification
- Affinity purified
- Immunogen
- MAOA antibody was raised using the middle region of MAOA corresponding to a region with amino acids NINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSE
- Top Product
- Discover our top product MAOA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAOA Blocking Peptide, catalog no. 33R-6729, is also available for use as a blocking control in assays to test for specificity of this MAOA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAOA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Monoamine Oxidase A (MAOA)
- Alternative Name
- MAOA (MAOA Products)
- Synonyms
- MAO-A antibody, 1110061B18Rik antibody, AA407771 antibody, Mao antibody, MAOA antibody, LOC100221249 antibody, Z-MAO antibody, maob antibody, moa antibody, wu:fb68b05 antibody, wu:fo76d11 antibody, wu:fq38g06 antibody, zgc:85761 antibody, monoamine oxidase A antibody, monoamine oxidase A L homeolog antibody, amine oxidase [flavin-containing] A antibody, monoamine oxidase antibody, MAOA antibody, Maoa antibody, maoa.L antibody, mll3668 antibody, maoa antibody, LOC100221249 antibody, mao antibody
- Background
- MAOA catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.
- Molecular Weight
- 60 kDa (MW of target protein)
-