NDUFC1 antibody
-
- Target See all NDUFC1 Antibodies
- NDUFC1 (NADH Dehydrogenase (Ubiquinone) 1, Subcomplex Unknown, 1, 6kDa (NDUFC1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NDUFC1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- NDUFC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGL
- Top Product
- Discover our top product NDUFC1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NDUFC1 Blocking Peptide, catalog no. 33R-8188, is also available for use as a blocking control in assays to test for specificity of this NDUFC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NDUFC1 (NADH Dehydrogenase (Ubiquinone) 1, Subcomplex Unknown, 1, 6kDa (NDUFC1))
- Alternative Name
- NDUFC1 (NDUFC1 Products)
- Synonyms
- 2310016K22Rik antibody, KFYI antibody, CI-KFYI antibody, NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1 antibody, NADH:ubiquinone oxidoreductase subunit C1 antibody, Ndufc1 antibody, NDUFC1 antibody
- Background
- NDUFC1 is the accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain.
- Molecular Weight
- 9 kDa (MW of target protein)
-