NDUFA9 antibody

Catalog No. ABIN631081

Product Details anti-NDUFA9 Antibody

Target: NDUFA9 (NADH Dehydrogenase (Ubiquinone) 1 alpha Subcomplex, 9, 39kDa (NDUFA9))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NDUFA9 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: NDUFA9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NDUFA9 Blocking Peptide, catalog no. 33R-7627, is also available for use as a blocking control in assays to test for specificity of this NDUFA9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDUFA9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NDUFA9

Target: NDUFA9 (NADH Dehydrogenase (Ubiquinone) 1 alpha Subcomplex, 9, 39kDa (NDUFA9))

Alternative Name: NDUFA9 (NDUFA9 Products)

Synonyms: ndufs2l antibody, wu:fc41f12 antibody, zgc:112513 antibody, GB10406 antibody, NDUFA9 antibody, DDBDRAFT_0203708 antibody, DDBDRAFT_0302549 antibody, DDB_0203708 antibody, DDB_0302549 antibody, 1010001N11Rik antibody, CC6 antibody, CI-39k antibody, CI39k antibody, NDUFS2L antibody, SDR22E1 antibody, NADH:ubiquinone oxidoreductase subunit A9 antibody, NADH:ubiquinone oxidoreductase subunit A9 L homeolog antibody, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9a antibody, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial antibody, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 9 antibody, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa antibody, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 antibody, NDUFA9 antibody, ndufa9.L antibody, ndufa9 antibody, ndufa9a antibody, LOC551866 antibody, Ndufa9 antibody

Background: The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane.

Molecular Weight: 42 kDa (MW of target protein)