Cytochrome C1 antibody (Middle Region)
-
- Target See all Cytochrome C1 (CYC1) Antibodies
- Cytochrome C1 (CYC1)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Cytochrome C1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CYC1 antibody was raised against the middle region of CYC1
- Purification
- Affinity purified
- Immunogen
- CYC1 antibody was raised using the middle region of CYC1 corresponding to a region with amino acids RWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPP
- Top Product
- Discover our top product CYC1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CYC1 Blocking Peptide, catalog no. 33R-8262, is also available for use as a blocking control in assays to test for specificity of this CYC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cytochrome C1 (CYC1)
- Alternative Name
- CYC1 (CYC1 Products)
- Synonyms
- DDBDRAFT_0184465 antibody, DDBDRAFT_0238603 antibody, DDB_0184465 antibody, DDB_0238603 antibody, UQCR4 antibody, 2610002H19Rik antibody, AA408921 antibody, fb80h03 antibody, im:6911272 antibody, sr:nyz104 antibody, wu:fb80h03 antibody, zgc:123089 antibody, cytochrome c1 antibody, cytochrome c-1 antibody, cytochrome c-1 L homeolog antibody, Sputw3181_0667 antibody, Shal_3628 antibody, Mpop_2472 antibody, Hneap_1140 antibody, cyc1 antibody, Bresu_2679 antibody, Fbal_3419 antibody, Sulku_2312 antibody, LOC100127128 antibody, ZMO0958 antibody, Rsph17029_0061 antibody, Mesop_2273 antibody, CYC1 antibody, Cyc1 antibody, cyc1.L antibody
- Background
- CYC1 is the heme-containing component of the cytochrome b-c1 complex, which accepts electrons from Rieske protein and transfers electrons to cytochrome c in the mitochondrial respiratory chain.
- Molecular Weight
- 35 kDa (MW of target protein)
-