TRIM63 antibody (Middle Region)

Catalog No. ABIN631125

Product Details anti-TRIM63 Antibody

Target: TRIM63 (Tripartite Motif Containing 63 (TRIM63))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIM63 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRIM63 antibody was raised against the middle region of TRIM63

Purification: Affinity purified

Immunogen: TRIM63 antibody was raised using the middle region of TRIM63 corresponding to a region with amino acids EQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIM63 Blocking Peptide, catalog no. 33R-2669, is also available for use as a blocking control in assays to test for specificity of this TRIM63 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM63 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIM63

Target: TRIM63 (Tripartite Motif Containing 63 (TRIM63))

Alternative Name: TRIM63 (TRIM63 Products)

Synonyms: IRF antibody, MURF1 antibody, MURF2 antibody, RNF28 antibody, SMRZ antibody, Murf antibody, Murf1 antibody, Rnf28 antibody, MuRF1 antibody, RF1 antibody, rnf30 antibody, MGC80210 antibody, TRIM63 antibody, MuRF antibody, fc50c07 antibody, trim63 antibody, wu:fc50c07 antibody, zgc:86757 antibody, tripartite motif containing 63 antibody, tripartite motif-containing 63 antibody, tripartite motif containing 63 S homeolog antibody, tripartite motif containing 63a antibody, TRIM63 antibody, Trim63 antibody, trim63.S antibody, trim63a antibody

Background: This gene encodes a member of the RING zinc finger protein family found in striated muscle and iris. The product of this gene is localized to the Z-line and M-line lattices of myofibrils, where titin's N-terminal and C-terminal regions respectively bind to the sarcomere. In vitro binding studies have shown that this protein also binds directly to titin near the region of titin containing kinase activity. Another member of this protein family binds to microtubules. Since these family members can form heterodimers, this suggests that these proteins may serve as a link between titin kinase and microtubule-dependent signal pathways in muscle.

Molecular Weight: 40 kDa (MW of target protein)