GSTK1 antibody (N-Term)
-
- Target See all GSTK1 Antibodies
- GSTK1 (Glutathione S-Transferase kappa 1 (GSTK1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GSTK1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GSTK1 antibody was raised against the N terminal of GSTK1
- Purification
- Affinity purified
- Immunogen
- GSTK1 antibody was raised using the N terminal of GSTK1 corresponding to a region with amino acids NLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPK
- Top Product
- Discover our top product GSTK1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GSTK1 Blocking Peptide, catalog no. 33R-6769, is also available for use as a blocking control in assays to test for specificity of this GSTK1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTK1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GSTK1 (Glutathione S-Transferase kappa 1 (GSTK1))
- Alternative Name
- GSTK1 (GSTK1 Products)
- Synonyms
- gst13-13 antibody, GSTK1 antibody, gstk1 antibody, DKFZp459M1330 antibody, GST antibody, GST 13-13 antibody, GST13 antibody, GST13-13 antibody, GSTK1-1 antibody, hGSTK1 antibody, 0610025I19Rik antibody, AW260476 antibody, DsbA-L antibody, GSTkappa antibody, glutathione S-transferase kappa 1 L homeolog antibody, glutathione S-transferase kappa 1 antibody, Glutathione S-transferase kappa 1 antibody, gstk1.L antibody, GSTK1 antibody, gstk1 antibody, PTRG_07256 antibody, Gstk1 antibody, LOC100350399 antibody
- Background
- GSTK1 is a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. GSTK1 is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells.
- Molecular Weight
- 25 kDa (MW of target protein)
-