Peripherin antibody (N-Term)
-
- Target See all Peripherin (PRPH) Antibodies
- Peripherin (PRPH)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Peripherin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRPH antibody was raised against the N terminal of PRPH
- Purification
- Affinity purified
- Immunogen
- PRPH antibody was raised using the N terminal of PRPH corresponding to a region with amino acids RFANFIEKVRFLEQQNAALRGELSQARGQEPARADQLCQQELRELRRELE
- Top Product
- Discover our top product PRPH Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRPH Blocking Peptide, catalog no. 33R-7897, is also available for use as a blocking control in assays to test for specificity of this PRPH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Peripherin (PRPH)
- Alternative Name
- PRPH (PRPH Products)
- Synonyms
- NEF4 antibody, PRPH1 antibody, Prph1 antibody, Perf antibody, nef4 antibody, prph1 antibody, MGC69454 antibody, if3 antibody, plasticin antibody, zgc:111926 antibody, peripherin antibody, peripherin L homeolog antibody, PRPH antibody, Prph antibody, prph antibody, prph.L antibody
- Background
- This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin.
- Molecular Weight
- 54 kDa (MW of target protein)
-