LONRF3 antibody (Middle Region)
-
- Target See all LONRF3 Antibodies
- LONRF3 (LON Peptidase N-terminal Domain and Ring Finger 3 (LONRF3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LONRF3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LONRF3 antibody was raised against the middle region of LONRF3
- Purification
- Affinity purified
- Immunogen
- LONRF3 antibody was raised using the middle region of LONRF3 corresponding to a region with amino acids LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQG
- Top Product
- Discover our top product LONRF3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LONRF3 Blocking Peptide, catalog no. 33R-4906, is also available for use as a blocking control in assays to test for specificity of this LONRF3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LONRF3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LONRF3 (LON Peptidase N-terminal Domain and Ring Finger 3 (LONRF3))
- Alternative Name
- LONRF3 (LONRF3 Products)
- Synonyms
- RNF127 antibody, 4932412G04Rik antibody, 5730439E01Rik antibody, A830039N02Rik antibody, AU023707 antibody, Rnf127 antibody, RGD1565451 antibody, LON peptidase N-terminal domain and ring finger 3 antibody, LONRF3 antibody, Lonrf3 antibody
- Background
- LONRF3 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear.
- Molecular Weight
- 84 kDa (MW of target protein)
-