SULT1A1 antibody (N-Term)
-
- Target See all SULT1A1 Antibodies
- SULT1A1 (Sulfotransferase Family, Cytosolic, 1A, Phenol-Preferring, Member 1 (SULT1A1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SULT1A1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SULT1 A1 antibody was raised against the N terminal of SULT1 1
- Purification
- Affinity purified
- Immunogen
- SULT1 A1 antibody was raised using the N terminal of SULT1 1 corresponding to a region with amino acids ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT
- Top Product
- Discover our top product SULT1A1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SULT1A1 Blocking Peptide, catalog no. 33R-2553, is also available for use as a blocking control in assays to test for specificity of this SULT1A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SULT1A1 (Sulfotransferase Family, Cytosolic, 1A, Phenol-Preferring, Member 1 (SULT1A1))
- Alternative Name
- SULT1A1 (SULT1A1 Products)
- Synonyms
- HAST1/HAST2 antibody, P-PST antibody, PST antibody, ST1A1 antibody, ST1A3 antibody, STP antibody, STP1 antibody, TSPST1 antibody, AI266890 antibody, Stp antibody, Stp1 antibody, ASTIV antibody, Mx-ST antibody, PST-1 antibody, St1a1 antibody, Stm antibody, Sult1a3 antibody, pst antibody, st1a3 antibody, stp antibody, stp1 antibody, tspst1 antibody, cSULT1A1 antibody, SULT1A2 antibody, SULT1A1 antibody, SIAT8-D antibody, ST8SiaIV antibody, Siat8d antibody, PST1 antibody, SIAT8D antibody, ST8SIA-IV antibody, sulfotransferase family 1A member 1 antibody, sulfotransferase family 1A, phenol-preferring, member 1 antibody, sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 antibody, sulfotransferase family 1A member 1 S homeolog antibody, sulfotransferase 1A1 antibody, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4 antibody, SULT1A1 antibody, Sult1a1 antibody, sult1a1 antibody, sult1a1.S antibody, LOC704658 antibody, LOC709318 antibody, St8sia4 antibody, ST8SIA4 antibody, LOC100064221 antibody
- Background
- Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1A1 is one of two phenol sulfotransferases with thermostable enzyme activity.
- Molecular Weight
- 34 kDa (MW of target protein)
-