Ketohexokinase antibody

Catalog No. ABIN631217

The Rabbit Polyclonal anti-Ketohexokinase antibody is suitable to detect Ketohexokinase in samples from Human. It has been validated for WB and IHC.

Quick Overview for Ketohexokinase antibody (ABIN631217)

Target: Ketohexokinase (KHK)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Ketohexokinase antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-Ketohexokinase Antibody

Purification: Affinity purified

Immunogen: KHK antibody was raised using a synthetic peptide corresponding to a region with amino acids FQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRV

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KHK Blocking Peptide, (ABIN938422), is also available for use as a blocking control in assays to test for specificity of this KHK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Ketohexokinase

Target: Ketohexokinase (KHK)

Alternative Name: KHK

Background: KHK is a ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose.KHK encodes the gene ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The splice variant presented encodes the highly active form found in liver, renal cortex, and small intestine, while the alternate variant encodes the lower activity form found in most other tissues.

Molecular Weight: 33 kDa (MW of target protein)