Ketohexokinase antibody
-
- Target See all Ketohexokinase (KHK) Antibodies
- Ketohexokinase (KHK)
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Ketohexokinase antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- KHK antibody was raised using a synthetic peptide corresponding to a region with amino acids FQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRV
- Top Product
- Discover our top product KHK Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KHK Blocking Peptide, catalog no. 33R-3036, is also available for use as a blocking control in assays to test for specificity of this KHK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Ketohexokinase (KHK)
- Alternative Name
- KHK (KHK Products)
- Synonyms
- wu:fj68h03 antibody, zgc:92219 antibody, zgc:92626 antibody, KHK antibody, khk antibody, KETHPRO antibody, ketohexokinase antibody, Ketohexokinase antibody, KHK antibody, khk antibody, Hhal_0921 antibody, AaeL_AAEL006316 antibody, Nwat_0240 antibody, Khk antibody
- Background
- KHK is a ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose.KHK encodes the gene ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The splice variant presented encodes the highly active form found in liver, renal cortex, and small intestine, while the alternate variant encodes the lower activity form found in most other tissues.
- Molecular Weight
- 33 kDa (MW of target protein)
-