LANCL2 antibody
-
- Target See all LANCL2 Antibodies
- LANCL2 (LanC like 2 (LANCL2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LANCL2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- LANCL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYK
- Top Product
- Discover our top product LANCL2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LANCL2 Blocking Peptide, catalog no. 33R-2598, is also available for use as a blocking control in assays to test for specificity of this LANCL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LANCL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LANCL2 (LanC like 2 (LANCL2))
- Alternative Name
- LANCL2 (LANCL2 Products)
- Synonyms
- 1700003F10Rik antibody, GPR69B antibody, TASP antibody, LanC (bacterial lantibiotic synthetase component C)-like 2 antibody, LanC like 2 antibody, Lancl2 antibody, LANCL2 antibody
- Background
- LANCL2 is necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.
- Molecular Weight
- 51 kDa (MW of target protein)
-