NUDCD1 antibody (N-Term)

Catalog No. ABIN631265

Product Details anti-NUDCD1 Antibody

Target: NUDCD1 (NudC Domain Containing 1 (NUDCD1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NUDCD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NUDCD1 antibody was raised against the N terminal of NUDCD1

Purification: Affinity purified

Immunogen: NUDCD1 antibody was raised using the N terminal of NUDCD1 corresponding to a region with amino acids EVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAVAEVKLRDDQY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NUDCD1 Blocking Peptide, catalog no. 33R-2773, is also available for use as a blocking control in assays to test for specificity of this NUDCD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUDCD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NUDCD1

Target: NUDCD1 (NudC Domain Containing 1 (NUDCD1))

Alternative Name: NUDCD1 (NUDCD1 Products)

Synonyms: Cml66 antibody, NUDCD1 antibody, CML66 antibody, OVA66 antibody, 4921532K09Rik antibody, AA407246 antibody, AW260430 antibody, AW556235 antibody, CML66-L antibody, RGD1310624 antibody, im:6901299 antibody, im:6912119 antibody, wu:fc11c02 antibody, zgc:110705 antibody, cml66 antibody, NudC domain containing 1 antibody, NudC domain-containing protein 1 antibody, NudC domain containing 1 S homeolog antibody, NUDCD1 antibody, nudcd1 antibody, CpipJ_CPIJ019282 antibody, nudc1 antibody, LOC777229 antibody, Nudcd1 antibody, nudcd1.S antibody

Background: NUDCD1 (CML66) contains 1 CS domain. It may play an oncogenic role in ways of favoring tumor cells proliferation, invasion and metastasis-associated with multiple pathways.

Molecular Weight: 67 kDa (MW of target protein)