RHPN1 antibody (Middle Region)
-
- Target See all RHPN1 Antibodies
- RHPN1 (Rhophilin, rho GTPase Binding Protein 1 (RHPN1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RHPN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RHPN1 antibody was raised against the middle region of RHPN1
- Purification
- Affinity purified
- Immunogen
- RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SAKNRWRLVGPVHLTRGEGGFGLTLRGDSPVLIAAVIPGSQAAAAGLKEG
- Top Product
- Discover our top product RHPN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RHPN1 Blocking Peptide, catalog no. 33R-8299, is also available for use as a blocking control in assays to test for specificity of this RHPN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHPN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RHPN1 (Rhophilin, rho GTPase Binding Protein 1 (RHPN1))
- Alternative Name
- RHPN1 (RHPN1 Products)
- Synonyms
- si:ch1073-260o7.1 antibody, ODF5 antibody, RHOPHILIN antibody, RHPN antibody, BB023497 antibody, Grbp antibody, Rhophilin antibody, mKIAA1929 antibody, rhophilin, Rho GTPase binding protein 1 antibody, rhophilin Rho GTPase binding protein 1 antibody, rhpn1 antibody, RHPN1 antibody, Rhpn1 antibody
- Background
- RHPN1 has no enzymatic activity. RHPN1 may serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho signal to other molecules.
- Molecular Weight
- 73 kDa (MW of target protein)
-