PRKAR1B antibody (Middle Region)
-
- Target See all PRKAR1B Antibodies
- PRKAR1B (Protein Kinase, CAMP-Dependent, Regulatory, Type I, beta (PRKAR1B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRKAR1B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRKAR1 B antibody was raised against the middle region of PRKAR1
- Purification
- Affinity purified
- Immunogen
- PRKAR1 B antibody was raised using the middle region of PRKAR1 corresponding to a region with amino acids LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT
- Top Product
- Discover our top product PRKAR1B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRKAR1B Blocking Peptide, catalog no. 33R-5240, is also available for use as a blocking control in assays to test for specificity of this PRKAR1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRKAR1B (Protein Kinase, CAMP-Dependent, Regulatory, Type I, beta (PRKAR1B))
- Alternative Name
- PRKAR1B (PRKAR1B Products)
- Synonyms
- PRKAR1B antibody, AI385716 antibody, RIbeta antibody, RGD1563094 antibody, PRKAR1 antibody, zgc:153624 antibody, prkar1 antibody, protein kinase cAMP-dependent type I regulatory subunit beta antibody, protein kinase, cAMP dependent regulatory, type I beta antibody, protein kinase cAMP-dependent type 1 regulatory subunit beta antibody, protein kinase, cAMP-dependent, regulatory, type I, beta antibody, protein kinase, cAMP-dependent, regulatory subunit type I beta S homeolog antibody, PRKAR1B antibody, prkar1b antibody, Prkar1b antibody, prkar1b.S antibody
- Background
- Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism.
- Molecular Weight
- 43 kDa (MW of target protein)
- Pathways
- Hedgehog Signaling, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Myometrial Relaxation and Contraction, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma
-