PRKRIR antibody
-
- Target See all PRKRIR Antibodies
- PRKRIR (Protein-Kinase, Interferon-Inducible Double Stranded RNA Dependent Inhibitor, Repressor of (p58 Repressor) (PRKRIR))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PRKRIR antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PRKRIR antibody was raised using a synthetic peptide corresponding to a region with amino acids VENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRTSPYRTVLRDNAIPT
- Top Product
- Discover our top product PRKRIR Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRKRIR Blocking Peptide, catalog no. 33R-9506, is also available for use as a blocking control in assays to test for specificity of this PRKRIR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKRIR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PRKRIR (Protein-Kinase, Interferon-Inducible Double Stranded RNA Dependent Inhibitor, Repressor of (p58 Repressor) (PRKRIR))
- Alternative Name
- PRKRIR (PRKRIR Products)
- Synonyms
- DAP4 antibody, P52rIPK antibody, THAP0 antibody, THAP12 antibody, 2900052B10Rik antibody, Dap4 antibody, Rpkrir antibody, dap4 antibody, p52ripk antibody, MGC75860 antibody, PRKRIR antibody, prkrir antibody, prkrir.S antibody, THAP domain containing 12 antibody, THAP domain containing 12 S homeolog antibody, THAP12 antibody, Thap12 antibody, thap12 antibody, thap12.S antibody
- Background
- PRKRIR is upstream regulator of interferon-induced serine/threonine protein kinase R (PKR). PRKRIR may block the PKR-inhibitory function of P58IPK, resulting in restoration of kinase activity and suppression of cell growth.
- Molecular Weight
- 88 kDa (MW of target protein)
-