LYRM1 antibody (Middle Region)

Catalog No. ABIN631306

Product Details anti-LYRM1 Antibody

Target: LYRM1 (LYR Motif Containing 1 (LYRM1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LYRM1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LYRM1 antibody was raised against the middle region of LYRM1

Purification: Affinity purified

Immunogen: LYRM1 antibody was raised using the middle region of LYRM1 corresponding to a region with amino acids KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LYRM1 Blocking Peptide, catalog no. 33R-4341, is also available for use as a blocking control in assays to test for specificity of this LYRM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYRM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LYRM1

Target: LYRM1 (LYR Motif Containing 1 (LYRM1))

Alternative Name: LYRM1 (LYRM1 Products)

Synonyms: A211C6.1 antibody, 1110065L10Rik antibody, 2310004B22Rik antibody, 4930404J24Rik antibody, RGD1563498 antibody, wu:fj36g10 antibody, zgc:92830 antibody, LYR motif containing 1 antibody, LYR motif containing 1 S homeolog antibody, LYRM1 antibody, lyrm1 antibody, Lyrm1 antibody, lyrm1.S antibody

Background: LYRM1 may promote cell proliferation and inhibition of apoptosis of preadipocytes.

Molecular Weight: 14 kDa (MW of target protein)