Myosin 9 antibody (Middle Region)

Catalog No. ABIN631312

Product Details anti-Myosin 9 Antibody

Target: Myosin 9 (MYH9)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Myosin 9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MYH9 antibody was raised against the middle region of MYH9

Purification: Affinity purified

Immunogen: MYH9 antibody was raised using the middle region of MYH9 corresponding to a region with amino acids DAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MYH9 Blocking Peptide, catalog no. 33R-1860, is also available for use as a blocking control in assays to test for specificity of this MYH9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYH9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Myosin 9

Target: Myosin 9 (MYH9)

Alternative Name: MYH9 (MYH9 Products)

Synonyms: BDPLT6 antibody, DFNA17 antibody, EPSTS antibody, FTNS antibody, MHA antibody, NMHC-II-A antibody, NMMHC-IIA antibody, NMMHCA antibody, C80049 antibody, D0Jmb2 antibody, E030044M24Rik antibody, Fltn antibody, Myhn-1 antibody, Myhn1 antibody, NMHC II-A antibody, NMHCIIA antibody, NMMHC II-a antibody, NMMHC-A antibody, TU72.6 antibody, fi22c04 antibody, myh9 antibody, myh9l2 antibody, wu:fi22c04 antibody, wu:fj85e11 antibody, zgc:162029 antibody, zgc:66164 antibody, NMMHC antibody, myosin antibody, non-muscle antibody, nonmuscle antibody, KLG/PTK7 antibody, dfna17 antibody, epsts antibody, ftns antibody, nmhc-ii-a antibody, nmmhca antibody, myosin heavy chain 9 antibody, myosin, heavy polypeptide 9, non-muscle antibody, myosin, heavy chain 9a, non-muscle antibody, myosin, heavy chain 9, non-muscle antibody, myosin, heavy chain 9, non-muscle L homeolog antibody, MYH9 antibody, Myh9 antibody, myh9a antibody, myh9.L antibody

Background: MYH9 is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain. The protein is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in MYH9 are the cause of non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness.

Molecular Weight: 226 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling, Integrin Complex