PTGES3 antibody

Catalog No. ABIN631318

Product Details anti-PTGES3 Antibody

Target: PTGES3 (Prostaglandin E Synthase 3 (Cytosolic) (PTGES3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTGES3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PTGES3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTGES3 Blocking Peptide, catalog no. 33R-4309, is also available for use as a blocking control in assays to test for specificity of this PTGES3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGES3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTGES3

Target: PTGES3 (Prostaglandin E Synthase 3 (Cytosolic) (PTGES3))

Alternative Name: PTGES3 (PTGES3 Products)

Synonyms: P23 antibody, TEBP antibody, cPGES antibody, PTGES3 antibody, 5730442A20Rik antibody, Ptges antibody, Tebp antibody, p23 antibody, sid3177 antibody, RGD1561913 antibody, CPGES antibody, cPGES-1 antibody, ptges3 antibody, wu:fb98d06 antibody, zgc:65804 antibody, zgc:77131 antibody, tebp antibody, wu:fb50a04 antibody, zgc:86751 antibody, prostaglandin E synthase 3 antibody, prostaglandin E synthase 3 (cytosolic) pseudogene antibody, prostaglandin E synthase 3a (cytosolic) antibody, prostaglandin E synthase 3 L homeolog antibody, prostaglandin E synthase 3b (cytosolic) antibody, PTGES3 antibody, LOC743066 antibody, Ptges3 antibody, ptges3a antibody, ptges3.L antibody, ptges3b antibody

Background: PTGES3 is a molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes.

Molecular Weight: 18 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Cellular Glucan Metabolic Process