TRIM49 antibody (Middle Region)
-
- Target See all TRIM49 Antibodies
- TRIM49 (Tripartite Motif Containing 49 (TRIM49))
-
Binding Specificity
- Middle Region
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRIM49 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRIM49 antibody was raised against the middle region of TRIM49
- Purification
- Affinity purified
- Immunogen
- TRIM49 antibody was raised using the middle region of TRIM49 corresponding to a region with amino acids VHITLHHEEANNDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTF
- Top Product
- Discover our top product TRIM49 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRIM49 Blocking Peptide, catalog no. 33R-9578, is also available for use as a blocking control in assays to test for specificity of this TRIM49 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM49 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRIM49 (Tripartite Motif Containing 49 (TRIM49))
- Alternative Name
- TRIM49 (TRIM49 Products)
- Synonyms
- RNF18 antibody, TRIM49A antibody, TRIM49L2 antibody, tripartite motif containing 49 antibody, TRIM49 antibody
- Background
- TRIM49 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein has been found to be preferentially expressed in testis.
- Molecular Weight
- 53 kDa (MW of target protein)
-