RFFL antibody (Middle Region)
-
- Target See all RFFL Antibodies
- RFFL (Ring Finger and FYVE-Like Domain Containing 1 (RFFL))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RFFL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RFFL antibody was raised against the middle region of RFFL
- Purification
- Affinity purified
- Immunogen
- RFFL antibody was raised using the middle region of RFFL corresponding to a region with amino acids KDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVT
- Top Product
- Discover our top product RFFL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RFFL Blocking Peptide, catalog no. 33R-4301, is also available for use as a blocking control in assays to test for specificity of this RFFL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFFL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RFFL (Ring Finger and FYVE-Like Domain Containing 1 (RFFL))
- Alternative Name
- RFFL (RFFL Products)
- Synonyms
- MGC84042 antibody, RFFL antibody, Rffl antibody, 1700051E09Rik antibody, 4930516L10Rik antibody, BG080975 antibody, Carp2 antibody, CARP-2 antibody, CARP2 antibody, FRING antibody, RIFIFYLIN antibody, RNF189 antibody, RNF34L antibody, ring finger and FYVE like domain containing E3 ubiquitin protein ligase antibody, ring finger and FYVE-like domain containing E3 ubiquitin protein ligase L homeolog antibody, ring finger and FYVE-like domain containing 1 antibody, ring finger and FYVE like domain containing protein antibody, ring finger and FYVE-like domain containing E3 ubiquitin protein ligase antibody, RFFL antibody, rffl.L antibody, Rffl antibody
- Background
- RFFL has E3 ubiquitin protein ligase activity.RFFL regulates the levels of CASP8 and CASP10 by targeting them for proteasomal degradation. RFFL may bind phosphatidylinositol phosphates.
- Molecular Weight
- 40 kDa (MW of target protein)
-