KLHL15 antibody
-
- Target See all KLHL15 Antibodies
- KLHL15 (Kelch-Like 15 (KLHL15))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KLHL15 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- KLHL15 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLDKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVC
- Top Product
- Discover our top product KLHL15 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KLHL15 Blocking Peptide, catalog no. 33R-9645, is also available for use as a blocking control in assays to test for specificity of this KLHL15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLHL15 (Kelch-Like 15 (KLHL15))
- Alternative Name
- KLHL15 (KLHL15 Products)
- Synonyms
- 6330500C13Rik antibody, wu:fa66h10 antibody, zgc:101051 antibody, RGD1563101 antibody, kelch-like 15 antibody, kelch-like family member 15 antibody, kelch like family member 15 antibody, Klhl15 antibody, klhl15 antibody, KLHL15 antibody
- Background
- KLHL15 is a member of the kelch-like family of proteins that share a common domain structure consisting of an N-terminal broad-complex, tramtrack, bric-a-brac/poxvirus and zinc finger domain and C-terminal kelch repeat motifs. KLHL15 may be involved in protein ubiquitination and cytoskeletal organization.
- Molecular Weight
- 66 kDa (MW of target protein)
-