Pallidin antibody
-
- Target See all Pallidin (PLDN) Antibodies
- Pallidin (PLDN) (Pallidin Homolog (PLDN))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Pallidin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PLDN antibody was raised using a synthetic peptide corresponding to a region with amino acids EGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTL
- Top Product
- Discover our top product PLDN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PLDN Blocking Peptide, catalog no. 33R-2437, is also available for use as a blocking control in assays to test for specificity of this PLDN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLDN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Pallidin (PLDN) (Pallidin Homolog (PLDN))
- Alternative Name
- PLDN (PLDN Products)
- Synonyms
- CG14133 antibody, Dmel\\CG14133 antibody, LOC100226487 antibody, pldn antibody, BLOS6 antibody, HPS9 antibody, PA antibody, PALLID antibody, PLDN antibody, Pldn antibody, BLOC-1 antibody, Stx13bp1 antibody, pa antibody, pallidin antibody, CG14133 gene product from transcript CG14133-RB antibody, biogenesis of lysosomal organelles complex 1 subunit 6 antibody, pallidin homolog (mouse) antibody, biogenesis of lysosomal organelles complex-1, subunit 6, pallidin antibody, Pallidin antibody, BLOC1S6 antibody, pldn antibody, Bloc1s6 antibody
- Background
- PLDN may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion.
- Molecular Weight
- 20 kDa (MW of target protein)
- Pathways
- Synaptic Vesicle Exocytosis
-