PEX26 antibody (Middle Region)
-
- Target See all PEX26 Antibodies
- PEX26 (Peroxisomal Biogenesis Factor 26 (PEX26))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PEX26 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PEX26 antibody was raised against the middle region of PEX26
- Purification
- Affinity purified
- Immunogen
- PEX26 antibody was raised using the middle region of PEX26 corresponding to a region with amino acids ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHK
- Top Product
- Discover our top product PEX26 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PEX26 Blocking Peptide, catalog no. 33R-2580, is also available for use as a blocking control in assays to test for specificity of this PEX26 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX26 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PEX26 (Peroxisomal Biogenesis Factor 26 (PEX26))
- Alternative Name
- PEX26 (PEX26 Products)
- Synonyms
- fk41g06 antibody, zgc:64014 antibody, wu:fk41g06 antibody, PBD7A antibody, PBD7B antibody, PEX26M1T antibody, Pex26pM1T antibody, 4632428M11Rik antibody, AI853212 antibody, peroxisomal biogenesis factor 26 antibody, peroxisomal biogenesis factor 26 L homeolog antibody, pex26 antibody, PEX26 antibody, pex26.L antibody, Pex26 antibody
- Background
- This gene belongs to the peroxin-26 gene family. It is probably required for protein import into peroxisomes.
- Molecular Weight
- 34 kDa (MW of target protein)
-