Golgin A7 antibody (Middle Region)
-
- Target See all Golgin A7 (GOLGA7) Antibodies
- Golgin A7 (GOLGA7)
-
Binding Specificity
- Middle Region
-
Reactivity
- Mouse, Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Golgin A7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GOLGA7 antibody was raised against the middle region of GOLGA7
- Purification
- Affinity purified
- Immunogen
- GOLGA7 antibody was raised using the middle region of GOLGA7 corresponding to a region with amino acids ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGL
- Top Product
- Discover our top product GOLGA7 Primary Antibody
-
anti-Golgin A7 (GOLGA7) (AA 1-137) antibody
GOLGA7 Reactivity: Human WB, ELISA, IP Host: Mouse Monoclonal 2H8 unconjugated
anti-Golgin A7 (GOLGA7) antibodyGOLGA7 Reactivity: Mouse, Human, Rat WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-Golgin A7 (GOLGA7) (N-Term) antibodyGOLGA7 Reactivity: Mouse, Human, Cow, Rabbit, Dog, Horse, Zebrafish (Danio rerio), Pig, Monkey, Bat, Xenopus laevis, Chicken WB Host: Rabbit Polyclonal unconjugated
anti-Golgin A7 (GOLGA7) (AA 71-120) antibodyGOLGA7 Reactivity: Mouse, Human, Rat, Cow, Rabbit, Dog, Horse, Guinea Pig, Pig, Monkey, Bat WB Host: Rabbit Polyclonal unconjugated
anti-Golgin A7 (GOLGA7) (AA 1-134) antibodyGOLGA7 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-Golgin A7 (GOLGA7) (N-Term) antibodyGOLGA7 Reactivity: Mouse, Human, Rat, Cow, Rabbit, Dog, Horse, Zebrafish (Danio rerio), Guinea Pig, Pig WB Host: Rabbit Polyclonal unconjugated
anti-Golgin A7 (GOLGA7) (Middle Region) antibodyGOLGA7 Reactivity: Mouse, Human, Rat, Cow, Rabbit, Dog, Horse, Zebrafish (Danio rerio), Guinea Pig WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GOLGA7 Blocking Peptide, catalog no. 33R-1074, is also available for use as a blocking control in assays to test for specificity of this GOLGA7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOLGA7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Golgin A7 (GOLGA7)
- Alternative Name
- GOLGA7 (GOLGA7 Products)
- Synonyms
- gcp16 antibody, golga7a antibody, hspc041 antibody, MGC79092 antibody, golga3ap1 antibody, AB041568 antibody, C130038N16Rik antibody, GCP16 antibody, GOLGA3AP1 antibody, HSPC041 antibody, R75586 antibody, GOLGA7A antibody, golgin A7 L homeolog antibody, golgin A7 antibody, golgi autoantigen, golgin subfamily a, 7 antibody, golga7.L antibody, golga7 antibody, Golga7 antibody, GOLGA7 antibody
- Background
- GOLGA7 may be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.
- Molecular Weight
- 16 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-
