RABGGTB antibody (Middle Region)
-
- Target See all RABGGTB Antibodies
- RABGGTB (Rab Geranylgeranyltransferase, beta Subunit (RABGGTB))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RABGGTB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RABGGTB antibody was raised against the middle region of RABGGTB
- Purification
- Affinity purified
- Immunogen
- RABGGTB antibody was raised using the middle region of RABGGTB corresponding to a region with amino acids PGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS
- Top Product
- Discover our top product RABGGTB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RABGGTB Blocking Peptide, catalog no. 33R-7095, is also available for use as a blocking control in assays to test for specificity of this RABGGTB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABGGTB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RABGGTB (Rab Geranylgeranyltransferase, beta Subunit (RABGGTB))
- Alternative Name
- RABGGTB (RABGGTB Products)
- Synonyms
- RABGGTB antibody, wu:fj12b07 antibody, zgc:56443 antibody, GGTB antibody, Rab geranylgeranyltransferase beta subunit antibody, Rab geranylgeranyltransferase, beta subunit antibody, Rab geranylgeranyl transferase, b subunit antibody, Rab geranylgeranyltransferase, beta subunit S homeolog antibody, RABGGTB antibody, AFUA_7G04460 antibody, NFIA_025430 antibody, ACLA_006160 antibody, PMAA_088560 antibody, AFLA_073740 antibody, TSTA_124030 antibody, TRV_03221 antibody, rabggtb antibody, Rabggtb antibody, rabggtb.S antibody
- Background
- RABGGTB catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.
- Molecular Weight
- 37 kDa (MW of target protein)
-