RABGGTB antibody (Middle Region)

Catalog No. ABIN631532

The Rabbit Polyclonal anti-RABGGTB antibody is suitable to detect RABGGTB in samples from Human. It has been validated for WB.

Quick Overview for RABGGTB antibody (Middle Region) (ABIN631532)

Target: RABGGTB (Rab Geranylgeranyltransferase, beta Subunit (RABGGTB))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RABGGTB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RABGGTB Antibody

Binding Specificity: Middle Region

Specificity: RABGGTB antibody was raised against the middle region of RABGGTB

Purification: Affinity purified

Immunogen: RABGGTB antibody was raised using the middle region of RABGGTB corresponding to a region with amino acids PGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RABGGTB Blocking Peptide, (ABIN5615723), is also available for use as a blocking control in assays to test for specificity of this RABGGTB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABGGTB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RABGGTB

Target: RABGGTB (Rab Geranylgeranyltransferase, beta Subunit (RABGGTB))

Alternative Name: RABGGTB

Background: RABGGTB catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.

Molecular Weight: 37 kDa (MW of target protein)