POLR2K antibody (Middle Region)
-
- Target See all POLR2K Antibodies
- POLR2K (Polymerase (RNA) II (DNA Directed) Polypeptide K, 7.0kDa (POLR2K))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This POLR2K antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- POLR2 K antibody was raised against the middle region of POLR2
- Purification
- Affinity purified
- Immunogen
- POLR2 K antibody was raised using the middle region of POLR2 corresponding to a region with amino acids DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR
- Top Product
- Discover our top product POLR2K Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
POLR2K Blocking Peptide, catalog no. 33R-2205, is also available for use as a blocking control in assays to test for specificity of this POLR2K antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POLR2K (Polymerase (RNA) II (DNA Directed) Polypeptide K, 7.0kDa (POLR2K))
- Alternative Name
- POLR2K (POLR2K Products)
- Synonyms
- ABC10-alpha antibody, RPABC4 antibody, RPB10alpha antibody, RPB12 antibody, RPB7.0 antibody, hRPB7.0 antibody, hsRPB10a antibody, MafY antibody, Mt1a antibody, rpb12 antibody, rpabc4 antibody, rpb7.0 antibody, hrpb7.0 antibody, hsrpb10a antibody, rpb10alpha antibody, abc10-alpha antibody, POLR2K antibody, polr2ka antibody, polr2kb antibody, zgc:171795 antibody, RNA polymerase II subunit K antibody, polymerase (RNA) II (DNA directed) polypeptide K antibody, polymerase (RNA) II subunit K antibody, polymerase (RNA) II subunit K L homeolog antibody, polymerase (RNA) II subunit K S homeolog antibody, POLR2K antibody, Polr2k antibody, polr2k antibody, polr2k.L antibody, polr2k.S antibody
- Background
- POLR2K is one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases.
- Molecular Weight
- 7 kDa (MW of target protein)
- Pathways
- Regulatory RNA Pathways
-