POLR2K antibody (Middle Region)

Catalog No. ABIN631534

Product Details anti-POLR2K Antibody

Target: POLR2K (Polymerase (RNA) II (DNA Directed) Polypeptide K, 7.0kDa (POLR2K))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POLR2K antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: POLR2 K antibody was raised against the middle region of POLR2

Purification: Affinity purified

Immunogen: POLR2 K antibody was raised using the middle region of POLR2 corresponding to a region with amino acids DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POLR2K Blocking Peptide, catalog no. 33R-2205, is also available for use as a blocking control in assays to test for specificity of this POLR2K antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POLR2K

Target: POLR2K (Polymerase (RNA) II (DNA Directed) Polypeptide K, 7.0kDa (POLR2K))

Alternative Name: POLR2K (POLR2K Products)

Synonyms: ABC10-alpha antibody, RPABC4 antibody, RPB10alpha antibody, RPB12 antibody, RPB7.0 antibody, hRPB7.0 antibody, hsRPB10a antibody, MafY antibody, Mt1a antibody, rpb12 antibody, rpabc4 antibody, rpb7.0 antibody, hrpb7.0 antibody, hsrpb10a antibody, rpb10alpha antibody, abc10-alpha antibody, POLR2K antibody, polr2ka antibody, polr2kb antibody, zgc:171795 antibody, RNA polymerase II subunit K antibody, polymerase (RNA) II (DNA directed) polypeptide K antibody, polymerase (RNA) II subunit K antibody, polymerase (RNA) II subunit K L homeolog antibody, polymerase (RNA) II subunit K S homeolog antibody, POLR2K antibody, Polr2k antibody, polr2k antibody, polr2k.L antibody, polr2k.S antibody

Background: POLR2K is one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases.

Molecular Weight: 7 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways