METTL7B antibody (Middle Region)
-
- Target See all METTL7B Antibodies
- METTL7B (Methyltransferase Like 7B (METTL7B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This METTL7B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- METTL7 B antibody was raised against the middle region of METTL7
- Purification
- Affinity purified
- Immunogen
- METTL7 B antibody was raised using the middle region of METTL7 corresponding to a region with amino acids FVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLF
- Top Product
- Discover our top product METTL7B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
METTL7B Blocking Peptide, catalog no. 33R-3123, is also available for use as a blocking control in assays to test for specificity of this METTL7B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- METTL7B (Methyltransferase Like 7B (METTL7B))
- Alternative Name
- METTL7B (METTL7B Products)
- Synonyms
- ALDI antibody, 0610006F02Rik antibody, AI266817 antibody, RGD1305205 antibody, methyltransferase like 7B antibody, METTL7B antibody, Mettl7b antibody
- Background
- METTL7B belongs to the methyltransferase superfamily. It is a probable methyltransferase.
- Molecular Weight
- 22 kDa (MW of target protein)
-