METTL7B antibody (Middle Region)

Catalog No. ABIN631547

Product Details anti-METTL7B Antibody

Target: METTL7B (Methyltransferase Like 7B (METTL7B))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This METTL7B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: METTL7 B antibody was raised against the middle region of METTL7

Purification: Affinity purified

Immunogen: METTL7 B antibody was raised using the middle region of METTL7 corresponding to a region with amino acids FVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

METTL7B Blocking Peptide, catalog no. 33R-3123, is also available for use as a blocking control in assays to test for specificity of this METTL7B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for METTL7B

Target: METTL7B (Methyltransferase Like 7B (METTL7B))

Alternative Name: METTL7B (METTL7B Products)

Synonyms: ALDI antibody, 0610006F02Rik antibody, AI266817 antibody, RGD1305205 antibody, methyltransferase like 7B antibody, METTL7B antibody, Mettl7b antibody

Background: METTL7B belongs to the methyltransferase superfamily. It is a probable methyltransferase.

Molecular Weight: 22 kDa (MW of target protein)