LOC652825 (Middle Region) antibody
Reactivity: Human
WB
Host: Rabbit
Polyclonal
unconjugated
1 image
-
- Target
- LOC652825
- Binding Specificity
- Middle Region
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Application
- Western Blotting (WB)
- Specificity
- LOC652825 antibody was raised against the middle region of Loc652825
- Purification
- Affinity purified
- Immunogen
- LOC652825 antibody was raised using the middle region of Loc652825 corresponding to a region with amino acids QSRSFRILWLLEEIKQPYELKRYYRDSSTHLAPDSLKTIHPLGKSPVLEW
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LOC652825 Blocking Peptide, catalog no. 33R-7735, is also available for use as a blocking control in assays to test for specificity of this LOC652825 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC652825 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LOC652825
- Background
- The function of LOC652825 protein has not been widely studied, and is yet to be fully elucidated.
- Molecular Weight
- 35 kDa (MW of target protein)
-
You are here:
