KLHDC1 antibody (N-Term)

Catalog No. ABIN631564

Product Details anti-KLHDC1 Antibody

Target: KLHDC1 (Kelch Domain Containing 1 (KLHDC1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLHDC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KLHDC1 antibody was raised against the N terminal of KLHDC1

Purification: Affinity purified

Immunogen: KLHDC1 antibody was raised using the N terminal of KLHDC1 corresponding to a region with amino acids IDSGLWRMHLMEGELPASMSGSCGACINGKLYIFGGYDDKGYSNRLYFVN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLHDC1 Blocking Peptide, catalog no. 33R-3929, is also available for use as a blocking control in assays to test for specificity of this KLHDC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLHDC1

Target: KLHDC1 (Kelch Domain Containing 1 (KLHDC1))

Alternative Name: KLHDC1 (KLHDC1 Products)

Synonyms: MST025 antibody, kelch domain containing 1 antibody, KLHDC1 antibody, Klhdc1 antibody

Background: KLHDC1 contains 6 Kelch repeats. KLHDC1 and KLHDC2 have differential localization and activity in cultured mammalian cells. The exact function of KLHDC1 remains unknown.

Molecular Weight: 47 kDa (MW of target protein)